PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G12690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 326aa    MW: 35074.8 Da    PI: 5.1407
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G12690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT+eEde+l+ +++++G g+W++ ++  g+ R++k+c++rw +yl
  LPERR03G12690.1 14 RGRWTAEEDERLAGYIAKHGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     8*******************************99************97 PP

2Myb_DNA-binding491.4e-1568112248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g+  +eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  LPERR03G12690.1  68 GNIAKEEEDVIIKLHATLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      56668****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-21563IPR009057Homeodomain-like
PROSITE profilePS5129416.663961IPR017930Myb domain
SuperFamilySSF466891.21E-2811108IPR009057Homeodomain-like
SMARTSM007171.9E-111363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001674.17E-101661No hitNo description
PROSITE profilePS5129424.07962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2464116IPR009057Homeodomain-like
SMARTSM007173.0E-1566114IPR001005SANT/Myb domain
PfamPF002496.1E-1471112IPR001005SANT/Myb domain
CDDcd001676.21E-1272112No hitNo description
PfamPF066403.1E-56130326IPR010588Myb-related protein P, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MGRAPCCEKV GLKRGRWTAE EDERLAGYIA KHGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRAGVKRGNI AKEEEDVIIK LHATLGNRWS LIASHLPGRT DNEIKNYWNS HLSRQIHTYR  120
RTYTAASEAA VTIDMTKLQA AGKRRGGRTA GQSRKGDKKQ AEAKQAKPAA ADSTPLPESS  180
PPRAQSVDEA RSGSAVVDPE PSQQEQQPNN SSGSGTQDGP CSEVTATGPT SMDAMEIGGL  240
WEAESEFAEM EALLCSGAAP DGLQPVDVAA QADDLLDMDW DGFATDLWGN SAQNSGGLVH  300
DAGEPNMGCS SDELESFASW LLSDSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24121185110B-MYB
1h8a_C6e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126111e-165CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629329.10.0PREDICTED: myb-related protein P-like
SwissprotP278985e-96MYBP_MAIZE; Myb-related protein P
TrEMBLA0A0D9VT440.0A0A0D9VT44_9ORYZ; Uncharacterized protein
STRINGBGIOSGA010900-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.13e-70myb domain protein 12